Immunogen
Synthetic peptide directed towards the N terminal region of human SLC25A14
Application
Anti-SLC25A14 antibody produced in rabbit is suitable for western blotting at a concentration of 2.5μg/ml.
Biochem/physiol Actions
SLC25A14 is a mitochondrial uncoupling protein (UCP) belonging to the family of mitochondrial anion carrier proteins (MACP). The UCPs mediate the transfer of anions from inner to outer mitochondrial membrane and transfer of protons in the reverse direction. Altered expression of SLC25A14 gene has been observed in autism spectrum disorders and in cardiovascular disorders.
Sequence
Synthetic peptide located within the following region: SIVAEFGTFPVDLTKTRLQVQGQSIDARFKEIKYRGMFHALFRICKEEGV
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 41116126
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV43861-100UL