Immunogen
Synthetic peptide directed towards the middle region of human SLC25A24
Application
Anti-SLC25A24 antibody produced in rabbit is suitable for western blotting at a concentration of 2.5μg/ml.
Biochem/physiol Actions
SLC25A24 (APC1) is a short calcium-binding mitochondrial carrier (SCaMC) that exchanges phosphate ATP-Mg for phosphate across the inner mitochondrial membrane. Altered expression of gene encoding APC1 has been reported in autism spectrum disorders.
Sequence
Synthetic peptide located within the following region: FLFNPVTDIEEIIRFWKHSTGIDIGDSLTIPDEFTEDEKKSGQWWRQLLA
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 51473502
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV43937-100UL