Immunogen
Synthetic peptide directed towards the N terminal region of human SLC25A25
Biochem/physiol Actions
SLC25A25 is a member of family of calcium-binding mitochondrial carriers located in the inner membranes of mitochondria. It is ATP-Mg/Pi carrier and regulates the movement of adenine nucleotides in mitochondria. SLC25A25 maintains the homeostasis of ATP and Ca+2 cycling in the skeletal muscle.
Sequence
Synthetic peptide located within the following region: AVGLRRLGLHRTEGELQKIVQAGDKDLDGQLDFEEFVHYLQDHEKKLRLV
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 41116126
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV43761-100UL