Immunogen
Synthetic peptide directed towards the C terminal region of human SLC25A28
Application
Anti-SLC25A28 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml and for immunohistochemistry of paraffin-embedded tissue sections at a concentration of 4-8μg/ml.
Biochem/physiol Actions
SLC25A28 also known as mitoferrin 2 (MFRN2) belongs to mitochondrial solute carrier family.It transports mitochondrial iron into the developing erythrocytes. High concentrations of iron are highly toxic; the regulation of iron transport in the vertebrate cells by MFRN1 and 2 is therefore critical.
Sequence
Synthetic peptide located within the following region: NTQESLALNSHITGHITGMASAFRTVYQVGGVTAYFRGVQARVIYQIPST
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 41116126
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV44054-100UL