Immunogen
Synthetic peptide directed towards the middle region of human SLC25A38
Application
Anti-SLC25A38 antibody produced in rabbit is suitable for western blotting at a concentration of 0.25μg/ml and for immunohistochemistry of paraffin-embedded tissue sections at a concentration of 4-8μg/ml.
Biochem/physiol Actions
SLC25A38 belongs to the mitochondrial carrier family and is essential for the biosynthesis of heme during erythropoiesis. Mutations in the gene encoding this carrier protein result in erythroblast mitochondrial iron overload, characteristic of congenital sideroblastic anemias. SLC25A38 is overexpressed in acute lymphoblastic lymphoma and may be considered as a diagnostic marker.
Sequence
Synthetic peptide located within the following region: VGIYFGTLYSLKQYFLRGHPPTALESVMLGVGSRSVAGVCMSPITVIKTR
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 41116126
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV43978-100UL
