Immunogen
Synthetic peptide directed towards the N terminal region of human SLC39A12
Application
Anti-SLC39A12 antibody produced in rabbit is suitable for western blotting at a concentration of 0.5μg/ml.
Biochem/physiol Actions
SLC39A12 (ZIP-12) is a zinc transporter protein that is predominantly expressed in brain. Zinc transporters are critical in the maintenance of cellular Zn+2 homeostasis. The expression of ZIP-12 is important for neurulation and development of the central nervous system. It mediates the neurite outgrowth and neuronal differentiation and is required for embryonic viability.
Sequence
Synthetic peptide located within the following region: MCFRTKLSVSWVPLFLLLSRVFSTETDKPSAQDSRSRGSSGQPADLLQVL
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 51283932
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV44127-100UL