Immunogen
Synthetic peptide directed towards the N terminal region of human SLCO6A1
Application
Anti-SLCO6A1 (AB1) antibody produced in rabbit is suitable for western blotting at a concentration of 5.0μg/ml.
Biochem/physiol Actions
SLCO6A1 (GST) is an organic anion transporter expressed strongly in testis and weakly in brain (adult and fetal), placenta and spleen. It is a putative cancer/testis (CT) cell surface antigen that might serve as a marker in medulloblastoma.
Sequence
Synthetic peptide located within the following region: CCNNIRCFMIFYCILLICQGVVFGLIDVSIGDFQKEYQLKTIEKLALEKS
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 51283930
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV44138-100UL