General description
SPIB is a transcriptional stimulator that associates with PU-box and functions as a lymphoid enhancer. SPIB variants have been linked to primary biliary cirrhosis.
Rabbit Anti-SPIB antibody recognizes zebrafish, canine, pig, bovine, chicken, human, mouse, and rat SPIB.
Immunogen
Synthetic peptide directed towards the C terminal region of human SPIB
Application
Rabbit Anti-SPIB antibody can be used for western blot applications at 0.25μg/ml.
Biochem/physiol Actions
SPI1 (MIM 165170) and SPIB are members of a subfamily of ETS (see ETS1; MIM 164720) transcription factors. ETS proteins share a conserved ETS domain that mediates specific DNA binding. SPIB and SPI1 bind to a purine-rich sequence, the PU box (5-prime-GAGGAA-3-prime).
Sequence
Synthetic peptide located within the following region: GQQKGNRKRMTYQKLARALRNYAKTGEIRKVKRKLTYQFDSALLPAVRRA
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 41181548
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV31422-100UL