General description

The previously assigned protein identifier B3KR67 has been merged into Q9BQ16. Full details can be found on the UniProt database.

Immunogen

Synthetic peptide directed towards the middle region of human SPOCK3

Biochem/physiol Actions

Proteoglycans, which consist of a core protein and covalently linked glycosaminoglycans, are components of the extracellular matrix. SPOCK3 is a member of a novel Ca(2+)-binding proteoglycan familyProteoglycans, which consist of a core protein and covalently linked glycosaminoglycans, are components of the extracellular matrix. SPOCK3 encodes a member of a novel Ca(2+)-binding proteoglycan family.[supplied by OMIM].

Sequence

Synthetic peptide located within the following region: CPCPSDKPTSTSRNVKRACSDLEFREVANRLRDWFKALHESGSQNKKTKT

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.