Immunogen
Synthetic peptide directed towards the middle region of human SPOPL
Biochem/physiol Actions
SPOPL belongs to the Tdpoz family. It contains 1 BTB (POZ) domain and 1 MATH domain. In complex with a cullin, SPOPL may act in ubiquitination and proteasomal degradation processes.
Sequence
Synthetic peptide located within the following region: WNSNQATDIMETSGWKSMIQSHPHLVAEAFRALASAQCPQFGIPRKRLKQ
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 51183619
- Condition:
- New
- Availability:
- 3-5 Days
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- MPN:
- SAB2103683-100UL