General description
Squalene epoxidase (SQLE) is an NADPH-dependent flavoprotein monooxygenase that oxidizes squalene to 2,3,-oxidosqualene (squalene epoxide) which is the first oxygenation and rate-limiting step in sterol, ergosterol and cholesterol, biosynthesis.
Specificity
Anti-SQLE polyclonal antibody reacts with human, mouse, rat, pig, zebrafish, bovine, and canine squalene epoxidases.
Immunogen
Synthetic peptide directed towards the C terminal region of human SQLE
Application
Anti-SQLE polyclonal antibody is used to tag squalene epoxidase for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of squalene epoxidase in sterol, ergosterol and cholesterol, biosynthesis.
Biochem/physiol Actions
Squalene epoxidase catalyzes the first oxygenation step in sterol biosynthesis and is thought to be one of the rate-limiting enzymes in this pathway.
Sequence
Synthetic peptide located within the following region: KKSFYWARKTSHSFVVNILAQALYELFSATDDSLHQLRKACFLYFKLGGE
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 41181888
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV42101-100UL