General description
Suppression of tumorigenicity 14 (colon carcinoma) (ST14) is an intergral membrane serine protease that forms a complex with HAI-1. It is known to inhibit cell growth and functions as a target for miR-27b. Mutations in ST14 have been linked to icthyosis.
Rabbit Anti-ST14 antibody recognizes human, mouse, rat, bovine, and rabbit ST14.
Immunogen
Synthetic peptide directed towards the C terminal region of human ST14
Application
Rabbit Anti-ST14 antibody is suitable for western blot applications at a concentration of 0.25 μg/ml and for IHC at 4-8 μg/ml.
Biochem/physiol Actions
ST14 is an epithelial-derived, integral membrane serine protease. This protease forms a complex with the Kunitz-type serine protease inhibitor, HAI-1, and is found to be activated by sphingosine 1-phosphate. This protease has been shown to cleave and activate hepatocyte growth factor/scattering factor, and urokinase plasminogen activator, which suggest the function of this protease as an epithelial membrane activator for other proteases and latent growth factors. The expression of this protease has been associated with breast, colon, prostate, and ovarian tumors, which implicates its role in cancer invasion, and metastasis.
Sequence
Synthetic peptide located within the following region: SHVFPAGKAIWVTGWGHTQYGGTGALILQKGEIRVINQTTCENLLPQQIT
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 12352203
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV48056-100UL
