Immunogen

Synthetic peptide directed towards the C terminal region of human ST3GAL2

Application

Anti-ST3GAL2 antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.

Biochem/physiol Actions

ST3GAL2 (ST3 beta-galactoside alpha-2,3-sialyltransferase 2) gene encodes a type II membrane protein that belongs to the glycosyltransferase family 29. It plays a pivotal role in transfering the sialic acid from CMP-sialic acid to galactose-containing substrates. ST3GAL2 is a MSGb5 (stage-specific embryonic antigen-4) synthase and increased expression of ST3Gal II facilitates as a marker for renal carcinogenesis.

Sequence

Synthetic peptide located within the following region: ADSRGNWHHYWENNRYAGEFRKTGVHDADFEAHIIDMLAKASKIEVYRGN

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.