Anti-ST6GALNAC2 antibody produced in rabbit

General description

ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase is an enzyme encoded by the ST6GALNAC2 gene in humans. It belongs to the family of sialyltransferases. It is found in various human cell lines and is also expressed in most cell types with notable exceptions for several myeloid and lymphoid cell lines.

Immunogen

Synthetic peptide directed towards the middle region of human ST6GALNAC2

Application

Anti-ST6GALNAC2 antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.

Biochem/physiol Actions

ST6GALNAC2 is primarily expressed in skeletal muscle, heart, kidney, placenta, lung and leukocytes. Overexpression of ST6GALNAC2 abolishes the cell surface HECA-452/CLA expression, reduces the number of rolling leukocytes on P- and L-selectin-bearing substrates as well as enhances the median rolling velocity of remaining cells during the synthesis of the leukocyte selectin ligand on human P-selectin glycoprotein ligand-1. Increased expression of the sialyltransferase ST6GalNAc-II indirectly reduces the galactosylation of the O-glycan substrate.

Sequence

Synthetic peptide located within the following region: VNTMKNSLVSYWNLGFTSVPQGQDLQYIFIPSDIRDYVMLRSAILGVPVP

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.