Immunogen
Synthetic peptide directed towards the N terminal region of human STEAP3
Biochem/physiol Actions
AS an endosomal ferrireductase, STEAP3 is required for efficient transferrin-dependent iron uptake in erythroid cells. It participates in erythroid iron homeostasis by reducing Fe(3+) to Fe(2+) and can also reduce of Cu(2+) to Cu(1+), suggesting that it participates in copper homeostasis. STEAP3 uses NAD(+) as acceptor (By similarity). It may play a role downstream of p53/TP53 to interface apoptosis and cell cycle progression. STEAP3 is indirectly involved in exosome secretion by facilitating the secretion of proteins such as TCT
Sequence
Synthetic peptide located within the following region: LVGSGFKVVVGSRNPKRTARLFPSAAQVTFQEEAVSSPEVIFVAVFREHY
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 51201516
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV43536-100UL