Immunogen
Synthetic peptide directed towards the N terminal region of human STIP1
Application
Anti-STIP1 (AB1) antibody produced in rabbit can be used to tag stress-induced-phosphoprotein 1 (Hsp70/Hsp90-organizing protein) for detection and quantitation by using western blotting at a concentration of 1.25μg/ml.
Biochem/physiol Actions
Stress-induced-phosphoprotein 1 (STIP1) also referred to as Hsp70/Hsp90-organizing protein, HOP, STI1, STI1L or P60 is a co-chaperone that regulates and assists heat shock proteins (major chaperones). STIP1 facilitates the interaction of chaperones Hsp70 and Hsp90 for proper protein folding. Additionally, it assists as a novel biomarker for ovarian cancer. STIP1 secreted by human ovarian cancer cells binds to a bone morphogenetic protein (BMP) receptor, ALK2 (activin A receptor, type II-like kinase 2) and activates SMAD-ID3 signaling pathways. Hence, STIP1-ALK2 pathway promotes cell proliferation in ovarian cancer cells.
Sequence
Synthetic peptide located within the following region: ALEFLNRFEEAKRTYEEGLKHEANNPQLKEGLQNMEARLAERKFMNPFNM
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 51262912
- Condition:
- New
- Availability:
- 3-5 Days
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- MPN:
- AV46164-100UL