General description
Mouse polyclonal antibody raised against a full-length human SYT16 protein.
SYT16 (synaptotagmin XVI) is a putative membrane trafficking protein belonging to the synaptotagmin (Syt) gene family. It is composed of a single N-terminal transmembrane domain and a putative fatty-acylation region adjacent to the transmembrane domain.
Immunogen
SYT16 (AAH40924.1, 1 a.a. ~ 203 a.a) full-length human protein.
Sequence
MTRERMMGEKLFYLSHLHPEGEMKVTLVLEPRSNISSGGSPLSPSAVSHSDSTSSTQSLSHGGAPELLVGLSYNATTGRLSVEMIKGSHFRNLAVNRAPDTYGKLFLLNSVGQEMSRCKTSIRRGQPNPVYKETFVFQVALFQLSDVTLMISVYNRRTMKRKEMIGWIALGQNSSGEEEQDHWEEMKETKGQQICRWHTLLES
Application
Anti-SYT16 antibody produced in mouse is suitable for wstern blot analysis.
Biochem/physiol Actions
The activity of SYT16 (synaptotagmin XVI) is dependent on the Ca(2+) similar to all the members of Syt family proteins. It forms Ca(2+) independent oligomer. It may be involved in membrane and vesicular trafficking in specific tissues outside the brain.
Physical form
Solution in phosphate buffered saline, pH 7.4
Shipping Information:
Dry Ice Surcharge & Ice Pack Shipments: $40
More Information: https://cenmed.com/shipping-returns
- UPC:
- 51204100
- Condition:
- New
- Availability:
- 3-5 Days
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- MPN:
- SAB1408077-50UG
- Temperature Control Device:
- Yes