General description
The previously assigned protein identifier Q99MW7 has been merged into Q9D3R9. Full details can be found on the UniProt database.
Immunogen
Synthetic peptide directed towards the middle region of mouse TAF7L
Biochem/physiol Actions
TAF7I belongs to the family of TATA box binding protein (Tbp)-associated factors. Promoter selectivity for all three classes of eukaryotic RNA polymerases is brought about by multimeric protein complexes containing TATA box binding protein (TBP) and specific TBP-associated factors (TAFs).
Sequence
Synthetic peptide located within the following region: EGKAERKKYNWKHGITPPLKNVRKKRFRKTTKKLPDVKQVDEINFSEYTQ
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 12352203
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV37923-100UL