Immunogen

Synthetic peptide directed towards the middle region of human TBPL1

Biochem/physiol Actions

TBP-like 1 protein belongs to the TATA box-binding protein family but initiates transcription from TATA-less promoters. It plays critical role in spermatogenesis, embryonic development, male fertility and single nucleotide polymorphisms.

Sequence

Synthetic peptide located within the following region: LQKLGFQVIFTDFKVVNVLAVCNMPFEIRLPEFTKNNRPHASYEPELHPA

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.