General description
TBX15 codes for T-box transcription factor that regulates embryonic development. TBX15 mutations have been linked to Cousin syndrome.
Rabbit anti-TBX15 antibody recognizes human, mouse, rat, and canine TBX15.
The previously assigned protein identifier Q5JT54 has been merged into Q96SF7. Full details can be found on the UniProt database.
Immunogen
Synthetic peptide directed towards the C terminal region of human TBX15
Application
Rabbit anti-TBX15 antibody is suitable for western blot applications at a concentration of 1.25μg/ml and for IHC applications (using paraffin-embedded tissues) at 4-8μg/ml.
Biochem/physiol Actions
TBX15 is a probable transcriptional regulator involved in developmental processes.
Sequence
Synthetic peptide located within the following region: YGYNFPTSPRLAASPEKLSASQSTLLCSSPSNGAFGERQYLPSGMEHSMH
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 41116126
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV47723-100UL