ANTI-TBX21 (C15-1340-675)

General description

Rabbit polyclonal anti-TBX21 (AB1) antibody reacts with human, bovine, canine, and mouse T-box transcription factor 21 transcription factors.

T-box genes encode transcription factors that regulate developmental processes. T-box transcription factor 21 (TBX21) is the human ortholog of mouse Tbx21/Tbet, a lineage commitment regulator for the differentiation of interferon-gamma (IFNG) producting CD4 T helper (Th1) 1 cells.

TBX21 is a transcription factor that is involved in the development of T lymphocytes. Functional TBX21 variations have been associated with aspirin-induced asthma and clinical outcomes for inhaled corticosteroid therapy in asthma patients.

Immunogen

Synthetic peptide directed towards the N terminal region of human TBX21

Application

Rabbit Anti-TBX21 (AB1) antibody can be used for western blot assays at a concentration of 2.5μg/ml.

Rabbit polyclonal anti-TBX21 (AB1) antibody is used to tag T-box 21 for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of T-box transcription factor 21 in the differentiation of interferon-gamma (IFNG) producting CD4 T helper 1 (Th1) cells.

Biochem/physiol Actions

TBX21 is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. Expression of the human TBX21 correlates w

Sequence

Synthetic peptide located within the following region: FYPEPGAQDADERRGGGSLGSPYPGGALVPAPPSRFLGAYAYPPRPQAAG

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.