Immunogen

Synthetic peptide directed towards the C terminal region of human TCEB3

Application

Anti-TCEB3 antibody produced in rabbit is suitable for western blotting at a working concentration of 7.5 μg/ml. The recommended concentration for immunohistochemistry of paraffin-embedded tissue sections is 4-8 μg/ml.

Biochem/physiol Actions

Transcription elongation factor b mediates crosstalk between RNA processing factors, transcription apparatus and the chromatin. This crosstalk results in transcription elongation and optimum production of mRNA.

Sequence

Synthetic peptide located within the following region: AYDGPSTSSAHLAPVVSSTVSYDPRKPTVKKIAPMMAKTIKAFKNRFSRR

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.