General description
TEAD1 is a transcriptional factor that blocks the expression of prolactin in human uterine decidual cells. TEAD1 mutation has been linked to Sveinsson′s chorioretinal atrophy.
Rabbit Anti-TEAD1 antibody recognizes pig, zebrafish, human, mouse, rat, bovine, and canine TEAD1.
Immunogen
Synthetic peptide directed towards the C terminal region of human TEAD1
Application
Rabbit Anti-TEAD1 antibody is suitable for western blot applications at a concentration of 0.25 μg/ml and for IHC at 16 μg/ml.
Biochem/physiol Actions
TEAD1 is a transcriptional enhancer. It interacts with a muscle-specific cofactor to promote skeletal muscle gene expression. The mutation in the TEAD1 gene is the cause of Sveinsson′s chorioretinal atrophy
Sequence
Synthetic peptide located within the following region: YMMNSVLENFTILLVVTNRDTQETLLCMACVFEVSNSEHGAQHHIYRLVK
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 41181888
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV39521-100UL
