Immunogen
Synthetic peptide directed towards the C terminal region of human TEAD4
Biochem/physiol Actions
TEAD4 is a member of the transcriptional enhancer factor (TEF) family. The family members contain the TEA/ATTS DNA-binding domain. TEAD4 is preferentially expressed in skeletal muscle, and binds to the M-CAT regulatory element which directs muscle-specific gene expression. TEAD4 is encoded through the use of a non-AUG (TTG) translation initiation codon. This gene encodes a member of the transcriptional enhancer factor (TEF) family. The family members contain the TEA/ATTS DNA-binding domain. This member is preferentially expressed in skeletal muscle, and binds to the M-CAT regulatory element which directs muscle-specific gene expression. The protein is encoded through the use of a non-AUG (TTG) translation initiation codon. Three alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Sequence
Synthetic peptide located within the following region: MMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 41181888
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV38276-100UL