General description
The AP2 family of transcription factors is expressed during mammalian development, morphogenesis and in various malignancies. Transcription factor AP-2 gamma (activating enhancer binding protein 2 gamma) (TFAP2G, AP2gamma, ERF1, TFAP2G, AP2-gamma) is a retinoic acid-responsive gene involved in placental development and the progression of human breast cancer. AP2-gamma is required for development and maintenance of extra-embryonic membranes, trophectoderm.
Specificity
Anti-TFAP2C polyclonal antibody reacts with human, mouse, rat, bovine, canine, zebrafish, pig, and chicken transcription factor AP-2 gamma proteins.
Immunogen
Synthetic peptide directed towards the N terminal region of human TFAP2C
Application
Anti-TFAP2C polyclonal antibody is used to tag transcription factor AP-2 gamma for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of transcription factor AP-2 gamma in extra-embryonic membrane development during embryo gestation.
Biochem/physiol Actions
TFAP2C is a sequence-specific DNA-binding transcription factor involved in the activation of several developmental genes. The protein can act as either a homodimer or heterodimer with other family members and is induced during retinoic acid-mediated differentiation. It plays a role in the development of the eyes, face, body wall, limbs, and neural tube.The protein encoded by this gene is a sequence-specific DNA-binding transcription factor involved in the activation of several developmental genes. The encoded protein can act as either a homodimer or heterodimer with other family members and is induced during retinoic acid-mediated differentiation. It plays a role in the development of the eyes, face, body wall, limbs, and neural tube.
Sequence
Synthetic peptide located within the following region: MLWKITDNVKYEEDCEDRHDGSSNGNPRVPHLSSAGQHLYSPAPPLSHTG
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 12352203
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV38284-100UL