ANTI-TLE2 (C15-1340-715)

General description

TLE-2 is the human homolog of Drosophila E(sp1) that interacts with the replication and transcription activator (RTA) protein. Studies have reported that TLE2 can block RTA-mediated transactivation and replication.
Rabbit Anti-TLE2 antibody recognizes human, mouse, and rat TLE2

Immunogen

Synthetic peptide directed towards the N terminal region of human TLE2

Application

Rabbit Anti-TLE2 antibody can be used for western blot applications at a concentration of 1μg/ml.

Biochem/physiol Actions

TLE2 belongs to the WD repeat Groucho/TLE family. It contains 6 WD repeats. TLE2 is a transcriptional corepressor that binds to a number of transcription factors. It inhibits the transcriptional activation mediated by CTNNB1 and TCF family members in Wnt signaling. The effects of full-length TLE family members may be modulated by association with dominant-negative AES.

Sequence

Synthetic peptide located within the following region: VEEERPSGPGGGGKQRADEKEPSGPYESDEDKSDYNLVVDEDQPSEPPSP

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.