Immunogen
Synthetic peptide directed towards the N terminal region of human TMPRSS11D
Application
Anti-TMPRSS11D antibody produced in rabbit is suitable for western blotting at a concentration of 2.5μg/ml. It is also useful for immunohistochemistry at a concentration of 4-8μg/ml.
Biochem/physiol Actions
TMPRSS11D (transmembrane protease, serine 11D) gene also referred to as MGC150587, MGC150588 or HAT(human airway trypsin-like protease) encodes for a 418 amino acid containing type II integral membrane protein. HAT stimulates amphiregulin (AR) production via protease-activated receptor-2 (PAR-2) mediated ERK pathway and then releases it by TACE (tumor necrosis factor alpha-converting enzyme)-dependent mechanism. HAT also activates the PAR-2 and assists in regulating the cellular functions of human bronchial epithelial cells (HBEC). Additionally, it induces the fibroblast proliferation in bronchial airways by mediating the PAR-2-dependent MEK-MAPK pathway.
Sequence
Synthetic peptide located within the following region: RSSFQLLNVEYNSQLNSPATQEYRTLSGRIESLITKTFKESNLRNQFIRA
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 41181888
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV46418-100UL