Immunogen
The immunogen for anti-TNFRSF10A antibody: synthetic peptide derected towards the C terminal of human TNFRSF10A
Application
Anti-TNFRSF10A antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/ml.
Biochem/physiol Actions
TNFRSF10A or Death receptor 4 is a mediator of apoptosis and tumor suppression. Mutation in TNFRSF10A gene or dysfunction of the receptor results in tumor development and invasion. Polymorphism of Glu228Ala residue in TNFRSF10A is identified as a risk factor in metastatic prostate cancer after radiation therapy.
Sequence
Synthetic peptide located within the following region: RAGTAGPGDALYAMLMKWVNKTGRNASIHTLLDALERMEERHAKEKIQDL
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 12352207
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV02065-100UL