ANTI-TRIM17 (C15-1340-897)

General description

TRIM17 (Terf) is an E3 ubiquitin ligase that mediates Mcl-1 degradation and initiates apoptosis in neurons. Terf can also facilitate the degradation of ZWINT (a kinetochore protein) and decrease the proliferation of MCF7 breast cancer cells.
Rabbit Anti-TRIM17 antibody recognizes bovine, human, rat, and mouse TRIM17.

Immunogen

Synthetic peptide directed towards the middle region of human TRIM17

Application

Rabbit Anti-TRIM17 antibody is suitable for western blot (0.12 μg/ml) and IHC (4-8 μg/ml) applications.

Biochem/physiol Actions

TRIM17 encodes a protein that is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies. The protein is expressed at high levels in the testis, but its function is unknown.

Sequence

Synthetic peptide located within the following region: MKEPLSRKNNVSVQCPEVAPPTRPRTVCRVPGQIEVLRGFLEDVVPDATS

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.