General description
TRIM38 is a tripartite motif protein that inhibits Toll-like receptor 3 (TLR3)-mediated type I interferon signaling and NF-κB activation.
Rabbit Anti-TRIM38 antibody recognizes human TRIM38.
Immunogen
Synthetic peptide directed towards the middle region of human TRIM38
Application
Rabbit Anti-TRIM38 antibody is suitable for western blot applications at a concentration of 0.5 μg/ml.
Biochem/physiol Actions
TRIM38 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The function of this protein has not been identified.The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The function of this protein has not been identified.
Sequence
Synthetic peptide located within the following region: SPAVCAAVTALQNYLTEALKAMDKMYLSNNPNSHTDNNAKSSDKEEKHRK
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 51292915
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV34800-100UL