ANTI-TRIM62 (C15-1341-156)

General description

Tripartite motif containing 62 (TRIM62) is a cytoplasmic protein that functions as a RING finger E3 ubiquitin ligase. It is known to catalyze self-ubiquination.
Rabbit Anti-TRIM62 antibody recognizes canine, human, mouse, rat, and bovine TRIM62.

Immunogen

Synthetic peptide directed towards the N terminal region of human TRIM62

Application

Rabbit Anti-TRIM62 antibody is suitable for western blot applications at a concentration of 1.25 μg/ml.

Biochem/physiol Actions

TRIM62 contains 1 RING-type zinc finger, which is probably involved in mediating protein-protein interactions. RING-type zinc finger was identified in a group of proteins with a wide range of functions such as viral replication, signal transduction, and development. But the function of TRIM62 remains unknown.

Sequence

Synthetic peptide located within the following region: CSICLSIYQDPVSLGCEHYFCRRCITEHWVRQEAQGARDCPECRRTFAEP

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.