General description
TRMU codes for tRNA 5-methylaminomethyl-2-thiouridylate methyltransferase that catalyzes the 2-thiolation of uridine. Studies have reported that TRMU mutations affect the deafness-associated mutations in 12S ribosomal RNA.
Rabbit Anti-TRMU antibody recognizes bovine, canine, human, mouse, and rat TRMU.
Immunogen
Synthetic peptide directed towards the C terminal region of human TRMU
Application
Rabbit Anti-TRMU antibody is suitable for western blot applications at a concentration of 1μg/ml.
Biochem/physiol Actions
TRMU is a member of the trmU family. It is a mitochondria-specific tRNA-modifying enzyme that is required for the 2-thio modification of 5-taurinomethyl-2-thiouridine tRNA-Lys on the wobble position of the anticodon.This gene is a member of the trmU family. It encodes a mitochondria-specific tRNA-modifying enzyme that is required for the 2-thio modification of 5-taurinomethyl-2-thiouridine tRNA-Lys on the wobble position of the anticodon.
Sequence
Synthetic peptide located within the following region: ALATGQFAVFYKGDECLGSGKILRLGPSAYTLQKGQRRAGMATESPSDSP
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 41181888
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV48819-100UL