Immunogen
Synthetic peptide directed towards the N terminal region of human TRPM3
Biochem/physiol Actions
Transient receptor potential cation channel, subfamily M, member 3 (TRPM3) belongs to the TRP family of channels. These cation-selective channels that regulate homeostasis, calcium signaling, calcium entry and storage.
Sequence
Synthetic peptide located within the following region: ALVACKLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQSYKQD
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 51111717
- Condition:
- New
- Availability:
- 3-5 Days
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- MPN:
- AV35609-100UL
