General description
TTC6 codes for tetratricopeptide repeat domain 6 protein. It has been identified as a susceptibility locus for allergic diseases.
Rabbit Anti-TTC6 antibody recognizes human, canine, and mouse TTC6.
Immunogen
Synthetic peptide directed towards the C terminal region of human TTC6
Application
Rabbit Anti-TTC6 antibody is suitable for western blot applications at a concentration of 0.5μg/ml.
Biochem/physiol Actions
The functions of TTC6 remain unknown.
Sequence
Synthetic peptide located within the following region: MKDYQDAITLNPKYSLAYFNAGNIYFHHRQFSQASDYFSKALKFDPENEY
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 51286707
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV48498-100UL