General description

UBP1 is a transcription factor shown to effect expression of HIV Type 1.

Immunogen

Synthetic peptide directed towards the middle region of human UBP1

Biochem/physiol Actions

UBP1 is an important SF1-independent transcriptional activator stimulating P450scc expression in human placental JEG-3 cells, whereas LBP-9 modulates the action of UBP1, exerting both positive and negative effects

Sequence

Synthetic peptide located within the following region: GASQTSGEQIQPSATIQETQQWLLKNRFSSYTRLFSNFSGADLLKLTKED

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.