Immunogen
Synthetic peptide directed towards the N terminal region of human UNC93B1
Application
Anti-UNC93B1 antibody produced in rabbit is suitable for western blotting at a concentration of 5.0μg/ml.
Biochem/physiol Actions
Unc-93 homolog B1 (UNC93B1) is a transmembrane protein localized to the plasma membrane. It is involved in the trafficking of nucleic acid-sensing toll-like receptors (TLR) from endoplasmic reticulum to the endolysosomes. It regulates both innate and adaptive immune responses by regulating TLR signaling.
Sequence
Synthetic peptide located within the following region: LKNVLAASAGGMLTYGVYLGLLQMQLILHYDETYREVKYGNMGLPDIDSK
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 41181888
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV49979-100UL