Immunogen

Synthetic peptide directed towards the C terminal region of human UST

Application

Anti-UST antibody produced in rabbit is suitable for western blotting at a concentration of 2.5μg/mL. It is also useful for immunohistochemistry at a concentration of 4-8μ/mL.

Biochem/physiol Actions

UST (Uronyl-2-sulfotransferase) gene encodes for an enzyme that transfers sulfate to the 2-position of uronyl residues, in iduronyl residues in dermatan sulfate and glucuronyl residues in chondroitin sulfate. In chondroitin sulfate the sulfate group transfer occurs from 3′-phosphoadenosine 5′-phosphosulfate (PAPS) to position 2 of the GlcA residue.

Sequence

Synthetic peptide located within the following region: YFKGVLSIYKDPEHRKLGNMTVTVKKTVPSPEAVQILYQRMRYEYEFYHY

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.