Immunogen

Synthetic peptide directed towards the middle region of human UTX

Biochem/physiol Actions

UTX is a histone demethylase that specifically demethylates ′Lys-27′ of histone H3, thereby playing a central role in histone code. It demethylates trimethylated and dimethylated but not monomethylated H3 ′Lys-27′. UTX plays a central role in regulation of posterior development, by regulating HOX gene expression. Demethylation of ′Lys-27′ of histone H3 is concomitent with methylation of ′Lys-4′ of histone H3, and regulates the recruitment of the PRC1 complex and monoubiquitination of histone H2A.

Sequence

Synthetic peptide located within the following region: KTYIVHCQDCARKTSGNLENFVVLEQYKMEDLMQVYDQFTLAPPLPSASS

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.