Immunogen
Synthetic peptide directed towards the middle region of human VGLL2
Application
Anti-VGLL2 antibody produced in rabbit is suitable for western blotting at a concentration of 0.5μg/ml.
Biochem/physiol Actions
Vestigial-like family member 2 (VGLL2) acts as a co-factor of transcriptional enhancer factor 1 (TEF-1) and regulates transcription during skeletal muscle development. Members of VGLL family are involved in embryonic patterning, determination of cell fate, neural crest cell survival and craniofacial development in zebrafish.
Sequence
Synthetic peptide located within the following region: RPPEAEYINSRCVLFTYFQGDISSVVDEHFSRALSQPSSYSPSCTSSKAP
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 12352202
- Condition:
- New
- Availability:
- 3-5 Days
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- MPN:
- AV50815-100UL