General description
Exportin 1 (CRM1 homolog, yeast) (XPO1, CRM1) is a nuclear export protein that mediates leucine-rich nuclear export signal (NES)-dependent protein transport. Exportin 1controls cell function by regulating the localization of factors such as Rev, U snRNAs, kinetoplastid spliced leader RNA, cyclin B, MPAK, MAPKAP kinase2 and hexokinase 2 (Hxk2).
Specificity
Anti-XPO1 polyclonal antibody reacts with bovine, canine, human, mouse, and rat exportin 1 (CRM1 homolog, yeast) proteins.
Immunogen
Synthetic peptide directed towards the C terminal region of human XPO1
Application
Anti-XPO1 polyclonal antibody is used to tag exportin 1 (CRM1 homolog, yeast) for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of exportin 1 management of cell function via control of the localization of regulatory proteins, splicing proteins and enzymes.
Biochem/physiol Actions
XPO1 mediates leucine-rich nuclear export signal (NES)-dependent protein transport. Exportin 1 specifically inhibits the nuclear export of Rev and U snRNAs. It is involved in the control of several cellular processes by controlling the localization of cyclin B, MPAK, and MAPKAP kinase 2. XPO1 also regulates NFAT and AP-1.The protein encoded by this gene mediates leucine-rich nuclear export signal (NES)-dependent protein transport. Exportin 1 specifically inhibits the nuclear export of Rev and U snRNAs. It is involved in the control of several cellular processes by controlling the localization of cyclin B, MPAK, and MAPKAP kinase 2. This protein also regulates NFAT and AP-1. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Sequence
Synthetic peptide located within the following region: NKLGGHITAEIPQIFDAVFECTLNMINKDFEEYPEHRTNFFLLLQAVNSH
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 41181888
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV40465-100UL