General description
ZBTB32 is a zinc-finger protein that can repress the expression of CIITA and MHC II genes during B cell differentiation.
Rabbit Anti-ZBTB32 recognizes bovine, mouse, canine, and human ZBTB32.
Immunogen
Synthetic peptide directed towards the N terminal region of human ZBTB32
Application
Rabbit Anti-ZBTB32 antibody can be used for western blot applications at a concentration of 0.5μg/ml.
Biochem/physiol Actions
ZBTB32 may play an essential role during the proliferative stages of primitive hematopoietic progenitors, possibly acting in concert with (a subset of) the Fanconi anemia proteins. This gene can also interact with GATA-2 and can modify GATA-2 transactivation capacity.
Sequence
Synthetic peptide located within the following region: PIRLPSPYGSDRLVQLAARLRPALCDTLITVGSQEFPAHSLVLAGVSQQL
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 41116126
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV31874-100UL