Immunogen
Synthetic peptide directed towards the N terminal region of human ZBTB33
Biochem/physiol Actions
ZBTB33 is a transcriptional regulator that binds to DNA at methylated CGCG sites and interacts with SMRT/NCoR histone deacetylase complexes. It represses the transcription of target genes of Wnt signaling pathway. ZBTB33 interacts with p120 catenin for DNA methylation-dependent gene silencing.
Sequence
Synthetic peptide located within the following region: MESRKLISATDIQYSGSLLNSLNEQRGHGLFCDVTVIVEDRKFRAHKNIL
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 41116126
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV38864-100UL