Immunogen
Synthetic peptide directed towards the middle region of human ZNF423
Biochem/physiol Actions
ZNF423 is the transcription factor that can both act as an activator or a repressor depending on the context. ZNF423 plays a central role in BMP signaling and olfactory neurogenesis. ZNF423 is associates with SMADs in response to BMP2 leading to activate
Sequence
Synthetic peptide located within the following region: CFTVFVQANKLQQHIFAVHGQEDKIYDCSQCPQKFFFQTELQNHTMSQHA
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Shipping Information:
Dry Ice Surcharge & Ice Pack Shipments: $40
More Information: https://cenmed.com/shipping-returns
- UPC:
- 51142035
- Condition:
- New
- Availability:
- 3-5 Days
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- MPN:
- SAB2108754-100UL
- Temperature Control Device:
- Yes
