General description
ZNF57 codes for a zinc finger protein. Genetic variations in ZNF57 may be a potential cause for Mendelian diseases such as hereditary deafness.
Rabbit Anti-ZNF57 antibody recognizes human ZNF57.
Immunogen
Synthetic peptide directed towards the N terminal region of human ZNF57
Application
Rabbit Anti-ZNF57 antibody is suitable for western blot applications at a concentration of 1 μg/ml.
Biochem/physiol Actions
ZNF57 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 13 C2H2-type zinc fingers and 1 KRAB domain. ZNF57 may be involved in transcriptional regulation.
Sequence
Synthetic peptide located within the following region: FTLEEWALLDSAQRDLYRDVMLETFRNLASVDDGTQFKANGSVSLQDMYG
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 51334419
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV34891-100UL