General description
ZNF627 codes for a zinc finger protein. ZNF627 polymorphisms are reportedly associated with the risk of myocardial infarction. Rabbit Anti-ZNF627 antibody recognizes human ZNF627.
Immunogen
Synthetic peptide directed towards the N terminal region of human ZNF627
Application
Rabbit Anti-ZNF627 antibody is suitable for western blot applications at a concentration of 0.125 μg/ml.
Biochem/physiol Actions
Located on chromosome 19, this gene encodes for zinc finger protein 627.
Sequence
Synthetic peptide located within the following region: GKQWEDQNIEDPFKIPRRNISHIPERLCESKEGGQGEETFSQIPDGILNK
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 51282008
- Condition:
- New
- Availability:
- 3-5 Days
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- MPN:
- AV34806-100UL
