General description
Helios/IKAROS family zinc finger 2 (ANF1A2, ZNF1A2, ZNFN1A2), a member of the Ikaros family of zinc-finger transcription factors, is a hematopoietic-specific transcription factors involved in the regulation of early lymphocyte development. Helios can form homodimers and heterodimers with other Ikaros family members to differentially regulate hematopoietic development.
Rabbit polyclonal anti-ZNFN1A2 antibody reacts with human, mouse, rat, chicken, and canine Helios/IKAROS family zinc finger 2 transcription factors.
Studies have reported that ZNFN1A2 has been deregulated in human leukemias.
Immunogen
Synthetic peptide directed towards the C terminal region of human ZNFN1A2
Application
Rabbit anti-ZNFN1A2 can be used for western blot (5.0μg/ml) and immunohistochemistry (4-8μg/ml, using paraffin-embedded tissues) applications.
Rabbit polyclonal anti-ZNFN1A2 antibody is used to tag helios/IKAROS family zinc finger 2 for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of helios/IKAROS family zinc finger 2 in early onset regulation of lymphocyte development.
Biochem/physiol Actions
Novel short isoforms of this gene, ZNFN1A2, are overexpressed in a patient with T-cell acute lymphoblastic leukemia and may contribute to the development of T-cell malignancies.
Sequence
Synthetic peptide located within the following region: REASPSNSCLDSTDSESSHDDHQSYQGHPALNPKRKQSPAYMKEDVKALD
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 51202807
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV31676-100UL