Inhibitors

Anti-MT1E metallothionein 1E, 25ul UN 1687 6.1 PG2

Nuclear receptor subfamily 4 group A member 1 (UniProt: P22736 also known as Early response protein NAK1, Nuclear hormone receptor NUR/77, Nur77, Orphan nuclear receptor HMR, Orphan nuclear receptor TR3, ST-59, Testicular receptor 3) is encoded by

Nuclear receptor subfamily 4 group A member 2 (UniProt: P43354 also known as Immediate-early response protein NOT, Orphan nuclear receptor NURR1, Transcriptionally-inducible nuclear receptor) and is encoded by the NR4A2 (also known as NOT, NURR1,

Nuclear receptor subfamily 4 group A member 2 (UniProt: P43354 also known as Immediate-early response protein NOT, Orphan nuclear receptor NURR1, Transcriptionally-inducible nuclear receptor) and is encoded by the NR4A2 (also known as NOT, NURR1,

cGMP-dependent 3&#8242,5&#8242-cyclic phosphodiesterase (UniProt: O00408 also known as EC:3.1.

Immunogen Recombinant protein corresponding to paired like homeobox 2a Sequence AAELLKAWQPAESGPGPFSGVLSSFHRKPGPALKTNLF Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)

Resistin (UniProt: Q9HD89 also known as Adipose tissue-specific secretory factor, ADSF,C/EBP-epsilon-regulated myeloid-specific secreted cysteine-rich protein, Cysteine-rich secreted protein A12-alpha-like 2, Cysteine-rich secreted protein FIZZ3)

ROCK (Rho-associated, coiled-coil containing protein kinase) has two isoforms, ROCK1 and ROCK2 that share 65% sequence similarity. ROCK has three domains that include the N-terminal catalytic domain (CAT), a middle coiled-coil domain that mediates

A cell-permeable, beta-lactone acyl protein thioesterase 1 (APT1) inhibitor (IC 50 = 0.67 &#181M, in an enzymatic assay) that is shown to specifically block Ras depalmitoylation, without affecting Ras acylation, in MDCK cells, both in vitro and in

A cell-permeable indolyl-fluorobenzamide compound that selectively inhibits actin assembly mediated by actin-related protein Arp2/3 complex of human, bovine, fission yeast S. pombe , and budding yeast S.

A cell-permeable indolyl-methoxyacetamide that exhibits no Arp2/3 inhibitory activity and serves as an inactive control for CK-666 (Cat. No.

A cell-permeable thiazolidinone compound that exhibits no Arp2/3 inhibitory activity and serves as an inactive control for CK-869 (Cat. No.