Inhibitors

cGMP-dependent 3&#8242,5&#8242-cyclic phosphodiesterase (UniProt: O00408 also known as EC:3.1.

Immunogen Recombinant protein corresponding to paired like homeobox 2a Sequence AAELLKAWQPAESGPGPFSGVLSSFHRKPGPALKTNLF Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)

Resistin (UniProt: Q9HD89 also known as Adipose tissue-specific secretory factor, ADSF,C/EBP-epsilon-regulated myeloid-specific secreted cysteine-rich protein, Cysteine-rich secreted protein A12-alpha-like 2, Cysteine-rich secreted protein FIZZ3)

ROCK (Rho-associated, coiled-coil containing protein kinase) has two isoforms, ROCK1 and ROCK2 that share 65% sequence similarity. ROCK has three domains that include the N-terminal catalytic domain (CAT), a middle coiled-coil domain that mediates

A cell-permeable, beta-lactone acyl protein thioesterase 1 (APT1) inhibitor (IC 50 = 0.67 &#181M, in an enzymatic assay) that is shown to specifically block Ras depalmitoylation, without affecting Ras acylation, in MDCK cells, both in vitro and in

A cell-permeable indolyl-fluorobenzamide compound that selectively inhibits actin assembly mediated by actin-related protein Arp2/3 complex of human, bovine, fission yeast S. pombe , and budding yeast S.

A cell-permeable indolyl-methoxyacetamide that exhibits no Arp2/3 inhibitory activity and serves as an inactive control for CK-666 (Cat. No.

A cell-permeable thiazolidinone compound that exhibits no Arp2/3 inhibitory activity and serves as an inactive control for CK-869 (Cat. No.

A cell-permeable dipeptide that reversibly blocks the homodimerization of aminoimidazole carboxamide ribonucleotide transformylase/inosine nomophosphate cyclohydrolase (ATIC) and inhibits its activity (K i = 691 nM, K d = 240 nM). AITC is a

A synthetic cell-permeable actinobacteria pyrimidotriazine-dione that selectively disrupts &#946-catenin-Tcf4 interaction (IC 50 = 0.8 &#181M in cell-free binding assays) and inhibits &#946-catenin-regulated cellular transcription activity (IC

A cell-permeable, potent, and highly selective BMPR (bone morphogenetic protein receptor) inhibitior (IC 50 against human ALK2/BMPR-I = 107.9 nM) that exhibits no inhibitory activity against ALK5, AMPK, FLK1/KDR/VEGRF2, or PDGFR&#946.

BRM/BRG1 ATP Inhibitor-1 is an allosteric dual Brahma homolog (BRM)/SWI/SNF related matrix-associated actin-dependent regulator of chromatin subfamily A member 2 (SMARCA2) and BRG1/SMARCA4 ATPase activity inhibitor (IC50s&lt:0.005 μM).