-
Add to Cart The item has been added575003-200UGa-Synuclein A53T, Human, Recombinant, E. coli, 200UG
Price: $1,405.01List Price: $1,561.12a-Synuclein A53T, Human, Recombinant, E. coli, 200UG -
Add to Cart The item has been added10-1015-10AC-DC-CE PHOSPHORAMIDITE
Price: $59.08List Price: $65.64General description This gene belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. -
Add to Cart The item has been addedHPA002911-100ULANTI-AADAC (C15-1445-701)
Price: $959.88List Price: $1,066.53Immunogen Arylacetamide deacetylase recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA044223-100ULANTI-AARS (C15-1458-076)
Price: $1,013.20List Price: $1,125.78Immunogen alanyl-tRNA synthetase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA022869-100ULANTI-AARSD1 (C15-1450-156)
Price: $959.88List Price: $1,066.53AARSD1 (alanyl-tRNA synthetase domain-containing protein 1) is a class-II aminoacyl-tRNA synthetase. Immunogen Alanyl-tRNA synthetase domain-containing protein 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies -
Add to Cart The item has been addedHPA023714-100ULANTI-AARSD1 (C15-1450-492)
Price: $959.88List Price: $1,066.53Immunogen alanyl-tRNA synthetase domain containing 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA078826-100ULANTI-ABCA4 ANTIBODY PRODUCED IN RABBIT
Price: $1,066.53List Price: $1,185.03Immunogen ATP binding cassette subfamily A member 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA062904-100ULANTI-ABCA5 (C15-1464-228)
Price: $1,013.20List Price: $1,125.78Immunogen Recombinant protein corresponding to ATP binding cassette subfamily A member 5 Sequence DQQLVYSLPFKDMDKFSGLFSALDSHSNLGVISYGVSMTTLEDVFLKLEVEAEIDQADYSVFTQQPLEEEMDSKSFDEMEQSLLILSETKASLVSTMS Application All Prestige Antibodies Powered by -
Add to Cart The item has been addedHPA074614-100ULANTI-ABCB1 ANTIBODY PRODUCED IN RABBIT (C15-1466-585)
Price: $1,066.53List Price: $1,185.03Immunogen ATP binding cassette subfamily B member 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA076011-100ULANTI-ABCC1 ANTIBODY PRODUCED IN RABBIT (C15-1466-814)
Price: $1,066.53List Price: $1,185.03Immunogen ATP binding cassette subfamily C member 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA057635-100ULANTI-ABCG4 ANTIBODY PRODUCED IN RABBIT (C15-1462-714)
Price: $1,066.53List Price: $1,185.03Immunogen ATP binding cassette subfamily G member 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA010729-100ULANTI-ABHD3
Price: $959.88List Price: $1,066.53ABHD3 (abhydrolase domain containing 3) belongs to the uncharacterized protein family called UPF0017. This protein contains α/β hydrolase fold, which is a catalytic domain found in multiple proteins.
