Epitope Mapping Kits

a-Synuclein A53T, Human, Recombinant, E. coli, 200UG

General description This gene belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system.

Immunogen Arylacetamide deacetylase recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen alanyl-tRNA synthetase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

AARSD1 (alanyl-tRNA synthetase domain-containing protein 1) is a class-II aminoacyl-tRNA synthetase. Immunogen Alanyl-tRNA synthetase domain-containing protein 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies

Immunogen alanyl-tRNA synthetase domain containing 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen ATP binding cassette subfamily A member 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen Recombinant protein corresponding to ATP binding cassette subfamily A member 5 Sequence DQQLVYSLPFKDMDKFSGLFSALDSHSNLGVISYGVSMTTLEDVFLKLEVEAEIDQADYSVFTQQPLEEEMDSKSFDEMEQSLLILSETKASLVSTMS Application All Prestige Antibodies Powered by

Immunogen ATP binding cassette subfamily B member 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen ATP binding cassette subfamily C member 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen ATP binding cassette subfamily G member 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

ABHD3 (abhydrolase domain containing 3) belongs to the uncharacterized protein family called UPF0017. This protein contains &#945/&#946 hydrolase fold, which is a catalytic domain found in multiple proteins.