Epitope Mapping Kits

NANS ( N -acetylneuraminate synthase) contains amino-terminal triosephosphate isomerase barrel domain and carboxyl-terminal antifreeze protein domain. The protein localizes in the cytoplasm and is ubiquitously expressed.

Immunogen N-acetyltransferase 10 (GCN5-related) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen N-acetyltransferase 10 (GCN5-related) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen N-acetyltransferase 14 (GCN5-related, putative) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen Recombinant protein corresponding to N-acetyltransferase 8 (putative) Sequence KPWTEYVDMTLCTDMSDITKSYLSERGSCFWVAESEEKVVGMVGALPVDDPTLREKRLQLFHLFVD Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated

Immunogen N-acetyltransferase 9 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by

NudE neurodevelopment protein 1-like 1 (NDEL1) is a multifunctional protein. It is crucial for the cell migration cytosolic dynein-associated responses.

Immunogen NADPH-dependent diflavin oxidoreductase 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

NDRG family member 3 (NDRG3) which is expressed in the testis and prostate gland, belongs to the N-myc down-regulated gene (NDRG) family. The gene encoding this protein is androgen regulated and located on chromosome 20q11.

The gene NDRG3 (N-myc downstream-regulated gene 3 protein) has been mapped to human chromosome 20q11.21-q11.

Immunogen NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 1, 7.5kDa recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)

Immunogen NADH dehydrogenase (ubiquinone) complex I, assembly factor 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)